PDB entry 3c76

View 3c76 on RCSB PDB site
Description: 1.07 A crystal structure of L133V mutant of nitrophorin 4 from Rhodnius prolixus complexed with ammonia at PH 7.5
Class: transport protein
Keywords: LIPOCALIN, BETA BARREL, FERRIC HEME, TRANSPORT PROTEIN, Iron, Metal-binding, Secreted, Vasoactive, Vasodilator
Deposited on 2008-02-06, released 2008-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.141
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Nitrophorin-4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
    • engineered (132)
  Domains in SCOPe 2.08: d3c76x1
• Heterogens: NH3, HEM, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3c76X (X:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdvyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk