PDB entry 3c75

View 3c75 on RCSB PDB site
Description: Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
Class: oxidoreductase
Keywords: copper proteins, electron transfer complex, TTQ, Electron transport, Oxidoreductase, Periplasm, Transport, Metal-binding, Pyrrolidone carboxylic acid
Deposited on 2008-02-06, released 2008-12-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c75a_
  • Chain 'B':
    Compound: amicyanin
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c75b_
  • Chain 'H':
    Compound: Methylamine dehydrogenase heavy chain
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Methylamine dehydrogenase heavy chain
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Methylamine dehydrogenase light chain
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c75l_
  • Chain 'M':
    Compound: Methylamine dehydrogenase light chain
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c75m_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c75A (A:)
    misaktlrpaiaaialfaigatgawaqdkitvtsekpvaaadvpadavvvgiekmkyltp
    evtikagetvywvngevmphnvafkkgivgedafrgemmtkdqayaitfneagsydyfct
    phpfmrgkvive
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c75A (A:)
    qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
    givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c75B (B:)
    misaktlrpaiaaialfaigatgawaqdkitvtsekpvaaadvpadavvvgiekmkyltp
    evtikagetvywvngevmphnvafkkgivgedafrgemmtkdqayaitfneagsydyfct
    phpfmrgkvive
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c75B (B:)
    qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
    givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive
    

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3c75L (L:)
    mlgnfrfddmveklsrrvagrtsrrgaigrlgtvlagaalvpllpvdrrgrvsranaagp
    aegvdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascyn
    ptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhcti
    spivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c75L (L:)
    vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3c75M (M:)
    mlgnfrfddmveklsrrvagrtsrrgaigrlgtvlagaalvpllpvdrrgrvsranaagp
    aegvdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascyn
    ptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhcti
    spivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c75M (M:)
    vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas