PDB entry 3c6s

View 3c6s on RCSB PDB site
Description: Crystal structure of Fab F22-4 in complex with a Shigella flexneri 2a O-Ag pentadecasaccharide
Class: immune system
Keywords: O-antigen, LPS, Shigella flexneri, antibody complex, IMMUNE SYSTEM
Deposited on 2008-02-05, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab F22-4 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
    Domains in SCOPe 2.07: d3c6sa1, d3c6sa2
  • Chain 'B':
    Compound: Fab F22-4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
  • Chain 'C':
    Compound: Fab F22-4 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
    Domains in SCOPe 2.07: d3c6sc1, d3c6sc2
  • Chain 'D':
    Compound: Fab F22-4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
  • Chain 'E':
    Compound: Fab F22-4 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
    Domains in SCOPe 2.07: d3c6se1, d3c6se2
  • Chain 'F':
    Compound: Fab F22-4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
  • Chain 'G':
    Compound: Fab F22-4 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
    Domains in SCOPe 2.07: d3c6sg1, d3c6sg2
  • Chain 'H':
    Compound: Fab F22-4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C6S (0-End)
  • Heterogens: PD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c6sA (A:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c6sA (A:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c6sC (C:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c6sC (C:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3c6sE (E:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c6sE (E:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3c6sG (G:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c6sG (G:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'H':
    No sequence available.