PDB entry 3c5t

View 3c5t on RCSB PDB site
Description: Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain
Class: Signaling protein/Signaling protein
Keywords: ligand-bound G protein-coupled receptor extracellular domain, G-protein coupled receptor, Glycoprotein, Membrane, Transducer, Transmembrane, Amidation, Cleavage on pair of basic residues, Secreted, Signaling protein-Signaling protein COMPLEX
Deposited on 2008-02-01, released 2008-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glucagon-like peptide 1 receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: Glucagon-like peptide-1 receptor(GLP1R)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43220
• Chain 'B':
  Compound: Exendin-4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26349 (0-End)
  Domains in SCOPe 2.08: d3c5tb1
• Heterogens: 10M, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3c5tB (B:)
  dlskqmeeeavrlfiewlknggpssgappps
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3c5tB (B:)
  dlskqmeeeavrlfiewlknggpss