PDB entry 3c5r

View 3c5r on RCSB PDB site
Description: Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences
Class: protein binding
Keywords: BARD1, Ankyrin repeat, helix, extended loop, four repeat, protein, ANK repeat, Disease mutation, Metal-binding, Nucleus, Zinc-finger, PROTEIN BINDING
Deposited on 2008-02-01, released 2008-05-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: brca1-associated ring domain protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BARD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99728 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.04: d3c5ra_
  • Chain 'B':
    Compound: brca1-associated ring domain protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BARD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99728 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.04: d3c5rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c5rA (A:)
    gidpftnhrgetllhiasikgdipsveyllqngsdpnvkdhagwtplheacnhghlkvve
    lllqhkalvnttgyqndsplhdaaknghvdivklllsygasrnavnifglrpvdytddes
    mksllllpeknesssas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5rA (A:)
    pftnhrgetllhiasikgdipsveyllqngsdpnvkdhagwtplheacnhghlkvvelll
    qhkalvnttgyqndsplhdaaknghvdivklllsygasrnavnifglrpvdytddesmks
    llllp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c5rB (B:)
    gidpftnhrgetllhiasikgdipsveyllqngsdpnvkdhagwtplheacnhghlkvve
    lllqhkalvnttgyqndsplhdaaknghvdivklllsygasrnavnifglrpvdytddes
    mksllllpeknesssas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5rB (B:)
    pftnhrgetllhiasikgdipsveyllqngsdpnvkdhagwtplheacnhghlkvvelll
    qhkalvnttgyqndsplhdaaknghvdivklllsygasrnavnifglrpvdytddesmks
    llll