PDB entry 3c5r

View 3c5r on RCSB PDB site
Description: Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences
Class: protein binding
Keywords: BARD1, Ankyrin repeat, helix, extended loop, four repeat, protein, ANK repeat, Disease mutation, Metal-binding, Nucleus, Polymorphism, Ubl conjugation, Zinc, Zinc-finger, PROTEIN BINDING
Deposited on 2008-02-01, released 2008-05-13
The last revision prior to the SCOP 1.75 freeze date was dated 2008-08-05, with a file datestamp of 2008-08-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: brca1-associated ring domain protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: BARD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99728 (6-End)
    • expression tag (3-5)
  Domains in SCOP 1.75: d3c5ra1
• Chain 'B':
  Compound: brca1-associated ring domain protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: BARD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99728 (6-End)
    • expression tag (3-5)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3c5rA (A:)
  gidpftnhrgetllhiasikgdipsveyllqngsdpnvkdhagwtplheacnhghlkvve
  lllqhkalvnttgyqndsplhdaaknghvdivklllsygasrnavnifglrpvdytddes
  mksllllpeknesssas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3c5rA (A:)
  pftnhrgetllhiasikgdipsveyllqngsdpnvkdhagwtplheacnhghlkvvelll
  qhkalvnttgyqndsplhdaaknghvdivklllsygasrnavnifglrpvdytddesmks
  llllp
  

  
  
• Chain 'B':
  No sequence available.