PDB entry 3c5k

View 3c5k on RCSB PDB site
Description: Crystal structure of human HDAC6 zinc finger domain
Deposited on 2008-01-31, released 2008-02-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.176
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBN7 (2-108)
      • expression tag (1)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3c5kA (A:)
gsplpwcphlvavcpipaagldvtqpcgdcgtiqenwvclscyqvycgryinghmlqhhg
nsghplvlsyidlsawcyycqayvhhqalldvkniahqnkfgedmphph

    Sequence, based on observed residues (ATOM records):
    >3c5kA (A:)
splpwcphlvavcpipaagldvtqpcgdcgtiqenwvclscyqvycgryinghmlqhhgn
sghplvlsyidlsawcyycqayvhhqalldvkniahqnkfgedmphph