PDB entry 3c59

View 3c59 on RCSB PDB site
Description: Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain
Class: Signaling protein/Signaling protein
Keywords: ligand-bound G protein-coupled receptor, G-protein coupled receptor, Glycoprotein, Membrane, Polymorphism, Transducer, Transmembrane, Amidation, Cleavage on pair of basic residues, Pharmaceutical, Secreted, Signaling protein/Signaling protein COMPLEX
Deposited on 2008-01-31, released 2008-02-19
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-06, with a file datestamp of 2008-05-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glucagon-like peptide 1 receptor
  Species: HOMO SAPIENS
  Gene: Glucagon-like peptide-1 receptor(GLP1R)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43220
• Chain 'B':
  Compound: Exendin-4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26349 (0-End)
    • modified residue (12)
  Domains in SCOP 1.75: d3c59b1
• Heterogens: 10M, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3c59B (B:)
  dlskqmeeeavrmfiewlknggpssgappps
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3c59B (B:)
  dlskqmeeeavrmfiewlknggpssga