PDB entry 3c59

View 3c59 on RCSB PDB site
Description: Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain
Class: Signaling protein/Signaling protein
Keywords: ligand-bound G protein-coupled receptor, G-protein coupled receptor, Glycoprotein, Membrane, Transducer, Transmembrane, Amidation, Cleavage on pair of basic residues, Secreted, Signaling protein-Signaling protein COMPLEX
Deposited on 2008-01-31, released 2008-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucagon-like peptide 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Glucagon-like peptide-1 receptor(GLP1R)
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Exendin-4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26349 (0-End)
      • modified residue (12)
    Domains in SCOPe 2.08: d3c59b1
  • Heterogens: 10M, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c59B (B:)
    dlskqmeeeavrmfiewlknggpssgappps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c59B (B:)
    dlskqmeeeavrmfiewlknggpssga