PDB entry 3c4s

View 3c4s on RCSB PDB site
Description: crystal structure of the ssl0352 protein from synechocystis sp. northeast structural genomics consortium target sgr42
Deposited on 2008-01-30, released 2008-02-12
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ssl0352 protein
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ssl0352
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ssl0352 protein
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ssl0352
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3c4sA (A:)
mifpgatvrvtnvddtyyrfeglvqrvsdgkaavlfengnwdklvtfrlseleavkpile
hhhhhh

    Sequence, based on observed residues (ATOM records):
    >3c4sA (A:)
mifpgatvrvtnvddtyyrfeglvqrvsdgkaavlfengnwdklvtfrlseleavkp

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3c4sB (B:)
mifpgatvrvtnvddtyyrfeglvqrvsdgkaavlfengnwdklvtfrlseleavkpile
hhhhhh

    Sequence, based on observed residues (ATOM records):
    >3c4sB (B:)
ifpgatvrvtnvddtyyrfeglvqrvsdgkaavlfengnwdklvtfrlseleavk