PDB entry 3c4h

View 3c4h on RCSB PDB site
Description: Human poly(ADP-ribose) polymerase 3, catalytic fragment in complex with an inhibitor DR2313
Class: transferase
Keywords: enzyme-inhibitor complex, catalytic fragment, Structural Genomics, Structural Genomics Consortium, SGC, Glycosyltransferase, NAD, Nucleus, Transferase
Deposited on 2008-01-30, released 2008-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ADP-ribose) polymerase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP3, ADPRT3, ADPRTL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6F1 (2-356)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3c4ha1, d3c4ha2, d3c4ha3
  • Heterogens: DRL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c4hA (A:)
    smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
    leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
    qalqavseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptl
    qhiwkvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyf
    asensksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarght
    epdptqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh