PDB entry 3c3y

View 3c3y on RCSB PDB site
Description: Crystal Structure of PFOMT, Phenylpropanoid and Flavonoid O-methyltransferase from M. crystallinum
Class: transferase
Keywords: plant secondary metabolism, O-methyltransferase
Deposited on 2008-01-29, released 2008-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.189
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-methyltransferase
    Species: Mesembryanthemum crystallinum [TaxId:3544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c3ya_
  • Chain 'B':
    Compound: O-methyltransferase
    Species: Mesembryanthemum crystallinum [TaxId:3544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c3yb_
  • Heterogens: CA, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c3yA (A:)
    mdfavmkqvkntgllqseelcqyilrtsvypreagflkelreaneshpdsymstsplagq
    lmsfvlklvnakktievgvftgysllltalsipddgkitaidfdreayeiglpfirkagv
    ehkinfiesdamlaldnllqgqesegsydfgfvdadkpnyikyherlmklvkvggivayd
    ntlwggtvaqpesevpdfmkenreavielnkllaadprieivhlplgdgitfcrrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3yA (A:)
    gllqseelcqyilrtsvypreagflkelreaneshpdsymstsplagqlmsfvlklvnak
    ktievgvftgysllltalsipddgkitaidfdreayeiglpfirkagvehkinfiesdam
    laldnllqgqesegsydfgfvdadkpnyikyherlmklvkvggivaydntlwggtvaqpe
    sevpdfmkenreavielnkllaadprieivhlplgdgitfcrrly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c3yB (B:)
    mdfavmkqvkntgllqseelcqyilrtsvypreagflkelreaneshpdsymstsplagq
    lmsfvlklvnakktievgvftgysllltalsipddgkitaidfdreayeiglpfirkagv
    ehkinfiesdamlaldnllqgqesegsydfgfvdadkpnyikyherlmklvkvggivayd
    ntlwggtvaqpesevpdfmkenreavielnkllaadprieivhlplgdgitfcrrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3yB (B:)
    gllqseelcqyilrtsvypreagflkelreaneshpdsymstsplagqlmsfvlklvnak
    ktievgvftgysllltalsipddgkitaidfdreayeiglpfirkagvehkinfiesdam
    laldnllqgqesegsydfgfvdadkpnyikyherlmklvkvggivaydntlwggtvaqpe
    sevpdfmkenreavielnkllaadprieivhlplgdgitfcrrly