PDB entry 3c3s

View 3c3s on RCSB PDB site
Description: Role of a Glutamate Bridge Spanning the Dimeric Interface of Human Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: metalloenzyme, Acetylation, Manganese, Metal-binding, Mitochondrion, Oxidoreductase, Polymorphism, Transit peptide
Deposited on 2008-01-28, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (161)
    Domains in SCOPe 2.07: d3c3sa1, d3c3sa2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (161)
    Domains in SCOPe 2.07: d3c3sb1, d3c3sb2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c3sA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwahayylqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3sA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwahayylqyknvrpdylkai
    wnvinwenvterymac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c3sB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwahayylqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3sB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwahayylqyknvrpdylkai
    wnvinwenvterymac