PDB entry 3c3i

View 3c3i on RCSB PDB site
Description: Evolution of chlorella virus dUTPase
Class: hydrolase
Keywords: dUTPase Chlorella virus, HYDROLASE
Deposited on 2008-01-28, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine triphosphatase
    Species: Paramecium bursaria Chlorella virus IL3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5I3E5
      • engineered (80)
      • engineered (83)
    Domains in SCOPe 2.07: d3c3ia_
  • Chain 'B':
    Compound: deoxyuridine triphosphatase
    Species: Paramecium bursaria Chlorella virus IL3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5I3E5
      • engineered (80)
      • engineered (83)
    Domains in SCOPe 2.07: d3c3ib_
  • Chain 'C':
    Compound: deoxyuridine triphosphatase
    Species: Paramecium bursaria Chlorella virus IL3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5I3E5
      • engineered (80)
      • engineered (83)
    Domains in SCOPe 2.07: d3c3ic_
  • Chain 'D':
    Compound: deoxyuridine triphosphatase
    Species: Paramecium bursaria Chlorella virus IL3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5I3E5
      • engineered (80)
      • engineered (83)
    Domains in SCOPe 2.07: d3c3id_
  • Heterogens: MG, DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c3iA (A:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvldlsdtargsggfgstgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3iA (A:)
    ssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygria
    prsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgva
    vvldlsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c3iB (B:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvldlsdtargsggfgstgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3iB (B:)
    ssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygria
    prsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgva
    vvldlsdtargsggfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c3iC (C:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvldlsdtargsggfgstgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3iC (C:)
    ssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygria
    prsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgva
    vvldlsdtargsggfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c3iD (D:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvldlsdtargsggfgstgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3iD (D:)
    ssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygria
    prsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgva
    vvldlsdtar