PDB entry 3c2u

View 3c2u on RCSB PDB site
Description: Structure of the two subsite D-xylosidase from Selenomonas ruminantium in complex with 1,3-bis[tris(hydroxymethyl)methylamino]propane
Class: hydrolase
Keywords: Tetramer; Glycoside Hydrolase; GH43; alpha-L-Arabinofuranosidase
Deposited on 2008-01-25, released 2008-04-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.136
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylosidase/arabinosidase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c2ua1, d3c2ua2
  • Chain 'B':
    Compound: Xylosidase/arabinosidase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c2ub1, d3c2ub2
  • Chain 'C':
    Compound: Xylosidase/arabinosidase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c2uc1, d3c2uc2
  • Chain 'D':
    Compound: Xylosidase/arabinosidase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c2ud1, d3c2ud2
  • Heterogens: B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c2uA (A:)
    mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
    ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
    lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
    diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
    nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
    dgwpvvvggqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgslt
    arpgflrlygreslqskftqahiarrwqsfnfdagtsvefspnsfqqmagltcyyntenw
    ssihvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysf
    dgetfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykeld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c2uB (B:)
    mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
    ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
    lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
    diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
    nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
    dgwpvvvggqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgslt
    arpgflrlygreslqskftqahiarrwqsfnfdagtsvefspnsfqqmagltcyyntenw
    ssihvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysf
    dgetfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c2uB (B:)
    mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
    ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
    lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
    diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
    nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
    dgwpvvvggqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgslt
    arpgflrlygreslqskftqahiarrwqsfnfdagtsvefspnsfqqmagltcyyntenw
    ssihvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysf
    dgetfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c2uC (C:)
    mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
    ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
    lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
    diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
    nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
    dgwpvvvggqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgslt
    arpgflrlygreslqskftqahiarrwqsfnfdagtsvefspnsfqqmagltcyyntenw
    ssihvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysf
    dgetfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c2uC (C:)
    mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
    ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
    lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
    diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
    nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
    dgwpvvvggqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgslt
    arpgflrlygreslqskftqahiarrwqsfnfdagtsvefspnsfqqmagltcyyntenw
    ssihvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysf
    dgetfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c2uD (D:)
    mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
    ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
    lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
    diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
    nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
    dgwpvvvggqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgslt
    arpgflrlygreslqskftqahiarrwqsfnfdagtsvefspnsfqqmagltcyyntenw
    ssihvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysf
    dgetfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c2uD (D:)
    mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
    ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
    lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
    diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
    nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
    dgwpvvvggqqgsleveapdlpqqewaptyeerddfdkdtlninfqtlripfsehlgslt
    arpgflrlygreslqskftqahiarrwqsfnfdagtsvefspnsfqqmagltcyyntenw
    ssihvtwneekgriidlvtadngtfsmplagaeipipdevktvhfkvsvrgriyqyaysf
    dgetfhtlpielpswklsddyvrgggfftgafvginaiditgtalpadfdyftykel