PDB entry 3c2t

View 3c2t on RCSB PDB site
Description: Evolution of chlorella virus dUTPase
Class: hydrolase
Keywords: dUTPase Chlorella Virus, HYDROLASE
Deposited on 2008-01-25, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine triphosphatase
    Species: Paramecium bursaria Chlorella virus IL3A [TaxId:46019]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c2ta_
  • Chain 'B':
    Compound: deoxyuridine triphosphatase
    Species: Paramecium bursaria Chlorella virus IL3A [TaxId:46019]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c2tb_
  • Heterogens: MG, DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c2tA (A:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidedytgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvldlsdtargsggfgstgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c2tA (A:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidedytgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c2tB (B:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidedytgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvldlsdtargsggfgstgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c2tB (B:)
    mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
    aprsglaykygidvlagvidedytgevkvilyntterdyiikkgdriaqlileqivtpgv
    avvl