PDB entry 3c2c

View 3c2c on RCSB PDB site
Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2
Class: electron transport protein (cytochrome)
Keywords: electron transport protein (cytochrome)
Deposited on 1983-11-03, released 1984-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c2
  Species: Rhodospirillum rubrum [TaxId:1085]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00092 (0-111)
    • conflict (44)
    • conflict (72)
  Domains in SCOPe 2.07: d3c2ca_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3c2cA (A:)
  egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
  twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk