PDB entry 3c2c

View 3c2c on RCSB PDB site
Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2
Class: electron transport protein (cytochrome)
Keywords: electron transport protein (cytochrome)
Deposited on 1983-11-03, released 1984-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00092 (0-111)
      • conflict (44)
      • conflict (72)
    Domains in SCOPe 2.08: d3c2ca_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c2cA (A:)
    egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
    twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk