PDB entry 3c2a
View 3c2a on RCSB PDB site
Description: Antibody Fab fragment 447-52D in complex with UG1033 peptide
Class: immune system
Keywords: antibody fab hiv-1 peptide, Envelope protein, IMMUNE SYSTEM
Deposited on
2008-01-24, released
2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-05-09, with a file datestamp of
2018-05-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: Fab 447-52D heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3c2ah1, d3c2ah2 - Chain 'I':
Compound: Fab 447-52D heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3c2ai1, d3c2ai2 - Chain 'L':
Compound: Fab 447-52D light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: Fab 447-52D light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: Envelope glycoprotein
Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: Envelope glycoprotein
Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>3c2aH (H:)
evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>3c2aI (I:)
evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.