PDB entry 3c2a

View 3c2a on RCSB PDB site
Description: Antibody Fab fragment 447-52D in complex with UG1033 peptide
Class: immune system
Keywords: antibody fab hiv-1 peptide, Envelope protein, IMMUNE SYSTEM
Deposited on 2008-01-24, released 2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 447-52D heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C2A (0-230)
    Domains in SCOPe 2.08: d3c2ah1, d3c2ah2
  • Chain 'I':
    Compound: Fab 447-52D heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C2A (0-230)
    Domains in SCOPe 2.08: d3c2ai1, d3c2ai2
  • Chain 'L':
    Compound: Fab 447-52D light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C2A (0-215)
  • Chain 'M':
    Compound: Fab 447-52D light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C2A (0-215)
  • Chain 'P':
    Compound: Envelope glycoprotein
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Envelope glycoprotein
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c2aH (H:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c2aI (I:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.