PDB entry 3c20

View 3c20 on RCSB PDB site
Description: Crystal Structure of Threonine-sensitive Aspartokinase from Methanococcus jannaschii with L-aspartate
Class: transferase
Keywords: kinase, allosetric inhibition, theronine-sensitive, ACT domain, Amino-acid biosynthesis, Threonine biosynthesis, Transferase
Deposited on 2008-01-24, released 2008-04-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c20a1, d3c20a2, d3c20a3
  • Chain 'B':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c20b1, d3c20b2, d3c20b3
  • Heterogens: ASP, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c20A (A:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c20A (A:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    memsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetni
    slvvseedvdkalkalkrefgdsflnnnlirdvsvdkdvcvisvvgagmrgakgiagkif
    tavsesganikmiaqgssevnisfvidekdllncvrklhekfiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c20B (B:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c20B (B:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    memsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetni
    slvvseedvdkalkalkrefgdksflnnnlirdvsvdkdvcvisvvgagmrgakgiagki
    ftavsesganikmiaqgssevnisfvidekdllncvrklhekfiek