PDB entry 3c1x

View 3c1x on RCSB PDB site
Description: Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-MET in complex with a Pyrrolotriazine based inhibitor
Class: transferase
Keywords: RECEPTOR TYROSINE KINASE, SIGNAL TRANSDUCTION, GRB2, SHC, ATP-binding, Glycoprotein, Membrane, Nucleotide-binding, Phosphoprotein, Proto-oncogene, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-01-24, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-372)
      • engineered (206)
      • engineered (284)
    Domains in SCOPe 2.06: d3c1xa_
  • Heterogens: CKK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c1xA (A:)
    mspidpmghhhhhhgrrrasvaagilvprgspgldgicsieelstslykkagsenlyfqg
    antvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglar
    dmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1xA (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadflpvkwm
    aleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpd
    plyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk