PDB entry 3c1v

View 3c1v on RCSB PDB site
Description: The 1.5 A Crystal structure of Ca2+-bound S100A4
Class: calcium binding protein
Keywords: S100A4, Ca2+-bound, calcium-bound, CALCIUM BINDING PROTEIN
Deposited on 2008-01-24, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: HOMO SAPIENS
    Gene: S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1va_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: HOMO SAPIENS
    Gene: S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1vb_
  • Chain 'C':
    Compound: Protein S100-A4
    Species: HOMO SAPIENS
    Gene: S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1vc_
  • Chain 'D':
    Compound: Protein S100-A4
    Species: HOMO SAPIENS
    Gene: S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1vd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c1vA (A:)
    mrgshhhhhhgsmacplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgk
    rtdeaafqklmsnldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1vA (A:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c1vB (B:)
    mrgshhhhhhgsmacplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgk
    rtdeaafqklmsnldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1vB (B:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c1vC (C:)
    mrgshhhhhhgsmacplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgk
    rtdeaafqklmsnldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1vC (C:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c1vD (D:)
    mrgshhhhhhgsmacplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgk
    rtdeaafqklmsnldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1vD (D:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqp