PDB entry 3c1s

View 3c1s on RCSB PDB site
Description: Crystal structure of GRX1 in glutathionylated form
Deposited on 2008-01-24, released 2008-12-09
The last revision was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaredoxin-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GRX1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GSH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3c1sA (A:)
mghhhhhhmvsqetikhvkdliaeneifvasktycpychaalntlfeklkvprskvlvlq
lndmkegadiqaalyeingqrtvpniyingkhiggnddlqelretgeleellepilan

    Sequence, based on observed residues (ATOM records):
    >3c1sA (A:)
vsqetikhvkdliaeneifvasktycpychaalntlfeklkvprskvlvlqlndmkegad
iqaalyeingqrtvpniyingkhiggnddlqelretgeleellepil