PDB entry 3c1n

View 3c1n on RCSB PDB site
Description: Crystal Structure of Allosteric Inhibition Threonine-sensitive Aspartokinase from Methanococcus jannaschii with L-threonine
Class: transferase
Keywords: kinase, allosteric inhibition, threonine-sensitive, ACT domain, Amino-acid biosynthesis, Threonine biosynthesis, Transferase
Deposited on 2008-01-23, released 2008-03-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.239
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c1na1, d3c1na2, d3c1na3
  • Chain 'B':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c1nb1, d3c1nb2, d3c1nb3
  • Chain 'C':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c1nc1, d3c1nc2, d3c1nc3
  • Chain 'D':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c1nd1, d3c1nd2, d3c1nd3
  • Heterogens: THR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c1nA (A:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1nA (A:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaiseeikeevkkiidsrieelekvligvaylgeltpksr
    dyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpll
    kegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdprl
    vptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitndm
    dsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnislvv
    seedvdkalkalkrefgdlnnnlirdvsvdkdvcvisvvgagmrgakgiagkiftavses
    ganikmiaqgssevnisfvidekdllncvrklhekfie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c1nB (B:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1nB (B:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    sdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnislv
    vseedvdkalkalkrefgdlnnnlirdvsvdkdvcvisvvgagmrgakgiagkiftavse
    sganikmiaqgssevnisfvidekdllncvrklhekfie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c1nC (C:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1nC (C:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    msivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnislvv
    seedvdkalkalkreflnnnlirdvsvdkdvcvisvvgagmrgakgiagkiftavsesga
    nikmiaqgssevnisfvidekdllncvrklhekfie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c1nD (D:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1nD (D:)
    tvmkfggtsvgsgerirhvakivtkrkkedvvvvsamsevtnalveisqqaldvrdiakv
    gdfikfirekhykaieeaiseeikeevkkiidsrieelekvligvaylgeltpksrdyil
    sfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpllkegi
    ipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdprlvpta
    rripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitndsivka
    istiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnislvvseedvd
    kalkalkrefgdlnnnlirdvsvdkdvcvisvvgagmrgakgiagkiftavsesganikm
    iaqgssevnisfvidekdllncvrklhekfie