PDB entry 3c1m

View 3c1m on RCSB PDB site
Description: Cyrstal Structure of threonine-sensitive aspartokinase from Methanococcus jannaschii with MgAMP-PNP and L-aspartate
Class: transferase
Keywords: kinase, allosteric inhibition, threonine-sensitive, ACT domain, Amino-acid biosynthesis, Threonine biosynthesis, Transferase
Deposited on 2008-01-23, released 2008-03-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c1ma1, d3c1ma2, d3c1ma3
  • Chain 'B':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c1mb1, d3c1mb2, d3c1mb3
  • Chain 'C':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c1mc1, d3c1mc2, d3c1mc3
  • Chain 'D':
    Compound: Probable aspartokinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3c1md1, d3c1md2, d3c1md3
  • Heterogens: MG, ASP, ANP, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c1mA (A:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1mA (A:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    memsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetni
    slvvseedvdkalkalkrefgdsflnnnlirdvsvdkdvcvisvvgagmrgakgiagkif
    tavsesganikmiaqgssevnisfvidekdllncvrklhekfiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c1mB (B:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1mB (B:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    memsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetni
    slvvseedvdkalkalkrefgdsflnnnlirdvsvdkdvcvisvvgagmrgakgiagkif
    tavsesganikmiaqgssevnisfvidekdllncvrklhekfiek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c1mC (C:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1mC (C:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    memsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetni
    slvvseedvdkalkalkrefgdgkksflnnnlirdvsvdkdvcvisvvgagmrgakgiag
    kiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c1mD (D:)
    mttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvr
    diakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpk
    srdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllp
    llkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdp
    rlvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn
    dmemsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetn
    islvvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkdvcvisvvgagmrgakgi
    agkiftavsesganikmiaqgssevnisfvidekdllncvrklhekfiektns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1mD (D:)
    ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
    iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
    rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
    lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
    lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
    memsdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetni
    slvvseedvdkalkalkrefgdksflnnnlirdvsvdkdvcvisvvgagmrgakgiagki
    ftavsesganikmiaqgssevnisfvidekdllncvrklhekfiek