PDB entry 3c1k

View 3c1k on RCSB PDB site
Description: Crystal structure of thrombin in complex with inhibitor 15
Class: hydrolase/hydrolase inhibitor
Keywords: thrombin, thrombin inhibitor complex, Acute phase, Blood coagulation, Cleavage on pair of basic residues, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hydrolase, Kringle, Protease, Secreted, Serine protease, Zymogen, Protease inhibitor, Serine protease inhibitor, Sulfation, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2008-01-23, released 2008-03-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.208
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3c1ka_
  • Chain 'B':
    Compound: hirugen
    Species: Hirudo medicinalis, synthetic [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: T15, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c1kA (A:)
    dcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcgas
    lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
    wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
    vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
    kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1kA (A:)
    dcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgaslis
    drwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwre
    nldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsvlqv
    vnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqm
    givswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

  • Chain 'B':
    No sequence available.