PDB entry 3c1f

View 3c1f on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V104K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, Calcium, Endonuclease, Metal-binding, Secreted, Zymogen
Deposited on 2008-01-23, released 2008-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: STAPHYLOCOCCUS AUREUS
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (43-44)
      • engineered (97)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.06: d3c1fa_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c1fA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealkrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1fA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealkrqglakvayvykgnntheqllrkaeaqa
    kkeklniws