PDB entry 3c1c

View 3c1c on RCSB PDB site
Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
Class: Structural PROTEIN/DNA
Keywords: Nucleosome, chromatin, Histone H3, trimethylation, histone modification, nucleosomal surface, nucleosomal array, Acetylation, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, Phosphoprotein, Ubl conjugation, Structural PROTEIN/DNA COMPLEX
Deposited on 2008-01-22, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.22
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3-like
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02302
      • conflict (85)
      • conflict (109)
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1cb1
  • Chain 'C':
    Compound: Histone H2A type 1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897
      • conflict (98)
    Domains in SCOPe 2.07: d3c1cc1
  • Chain 'D':
    Compound: Histone 2, H2bf
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: hist2h2bf, TGas058p09.1-001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1cd1
  • Chain 'E':
    Compound: Histone H3-like
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02302
      • conflict (85)
      • conflict (109)
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1cf1
  • Chain 'G':
    Compound: Histone H2A type 1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897
      • conflict (98)
    Domains in SCOPe 2.07: d3c1cg1
  • Chain 'H':
    Compound: Histone 2, H2bf
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: hist2h2bf, TGas058p09.1-001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c1ch1
  • Chain 'I':
    Compound: Palindromic 146bp Human Alpha satellite DNA
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: Palindromic 146bp Human Alpha satellite DNA
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c1cB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1cB (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c1cC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esskstksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1cC (C:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c1cD (D:)
    pdpaksapaakkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1cD (D:)
    rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3c1cF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1cF (F:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3c1cG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esskstksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1cG (G:)
    trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk
    triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3c1cH (H:)
    pdpaksapaakkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c1cH (H:)
    trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkyts
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.