PDB entry 3c12

View 3c12 on RCSB PDB site
Description: Crystal Structure of FlgD from Xanthomonas campestris: Insights into the Hook Capping Essential for Flagellar Assembly
Deposited on 2008-01-22, released 2008-12-09
The last revision was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.257
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar protein
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3c12A (A:)
dqvlkgaalvghnvlvpsaqvaidatgsakgvvaatsagfvnfeitdangtfvkqlsvpa
saagevsfawdgtdangnrmaagkygitatqtdtagaksklatyvdapvdsvtigsdgly
lnltglgtsplanvlrvs