PDB entry 3c0y

View 3c0y on RCSB PDB site
Description: Crystal structure of catalytic domain of human histone deacetylase HDAC7
Class: hydrolase
Keywords: HISTONE DEACETYLASE, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, Alternative splicing, Chromatin regulator, Cytoplasm, Hydrolase, Nucleus, Phosphoprotein, Polymorphism, Repressor, Transcription, Transcription regulation
Deposited on 2008-01-21, released 2008-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 7a
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC7A, HDAC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3c0ya1
  • Chain 'B':
    Compound: Histone deacetylase 7a
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC7A, HDAC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3c0yb_
  • Chain 'C':
    Compound: Histone deacetylase 7a
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC7A, HDAC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3c0yc_
  • Heterogens: ZN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c0yA (A:)
    gsraqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsr
    hpehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkld
    ngklagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqr
    las
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0yA (A:)
    tlpfttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasl
    eelqsvhserhvllygtnplsrlkldngklagllaqrmfvmlpcggvgvdtdtiwnelhs
    snaarwaagsvtdlafkvasrelkngfavvrppghhadhstamgfcffnsvaiacrqlqq
    qskaskilivdwdvhhgngtqqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgeg
    fnvnvawaggldppmgdpeylaafrivvmpiarefspdlvlvsagfdaaeghpaplggyh
    vsakcfgymtqqlmnlaggavvlalegghdltaicdaseacvaallgnrvdplseegwkq
    kpnlnairsleavirvhskywgcmqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c0yB (B:)
    gsraqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsr
    hpehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkld
    ngklagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqr
    las
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0yB (B:)
    pfttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkaslee
    lqsvhserhvllygtnplsvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvas
    relkngfavvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngt
    qqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpey
    laafrivvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlagga
    vvlalegghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhsky
    wgcmqrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c0yC (C:)
    gsraqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsr
    hpehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkld
    ngklagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqr
    las
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0yC (C:)
    ttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasleelq
    svhserhvllygtnlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkngf
    avvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyqd
    psvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafriv
    vmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlaleg
    ghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmq