PDB entry 3c0c

View 3c0c on RCSB PDB site
Description: X-ray Crystal Structure of the Rat Endophilin A2 SH3 Domain
Class: endocytosis
Keywords: endocytosis, SH3, voltage-gated calcium channel, Endosome, Lipid-binding, Membrane, Phosphoprotein, Proto-oncogene, SH3 domain
Deposited on 2008-01-19, released 2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endophilin-A2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sh3gl1, Sh3p8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3c0ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c0cA (A:)
    gamdpefmppldqpsckalydfependgelgfregdlitltnqidenwyegmlhgqsgff
    plsyvqvlvplpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0cA (A:)
    pldqpsckalydfependgelgfregdlitltnqidenwyegmlhgqsgffplsyvqvlv
    plpq