PDB entry 3c08

View 3c08 on RCSB PDB site
Description: Crystal structure the Fab fragment of matuzumab/EMD72000 (Fab72000)
Class: immune system
Keywords: fab fragment, antitumor, drug, immune system
Deposited on 2008-01-18, released 2008-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-15, with a file datestamp of 2008-04-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.226
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Matuzumab Fab Heavy chain
    Species: homo sapiens, mus musculus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C08 (0-222)
    Domains in SCOP 1.75: d3c08h1, d3c08h2
  • Chain 'L':
    Compound: Matuzumab Fab Light chain
    Species: homo sapiens, mus musculus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3C08
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3c08H (H:)
    qvqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtny
    nekfkskatmtvdtstntaymelsslrsedtavyycasrdydydgryfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c08H (H:)
    qvqlvqsgaevkkpgasvkvsckashwmhwvrqapgqglewigefnpsngrtnynekfks
    katmtvdtstntaymelsslrsedtavyycasrdydydgryfdywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'L':
    No sequence available.