PDB entry 3c04

View 3c04 on RCSB PDB site
Description: Structure of the P368G mutant of PMM/PGM from P. aeruginosa
Class: isomerase
Keywords: enzyme, mutant, Alginate biosynthesis, Isomerase, Lipopolysaccharide biosynthesis, Magnesium, Metal-binding, Multifunctional enzyme, Phosphoprotein
Deposited on 2008-01-18, released 2008-09-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase/phosphoglucomutase
    Species: Pseudomonas aeruginosa
    Gene: AlgC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26276 (Start-462)
      • engineered (367)
    Domains in SCOPe 2.01: d3c04a1, d3c04a2, d3c04a3, d3c04a4
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c04A (A:)
    mstakaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrls
    gpelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkiv
    vagetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcg
    ngvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlgla
    fdgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggr
    pvmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrds
    ehvfsafgsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglv
    rasnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c04A (A:)
    aptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelv
    kqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvaget
    laneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngvag
    viapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgdg
    drvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwk
    tghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfs
    afgsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnt
    tpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf