PDB entry 3c01

View 3c01 on RCSB PDB site
Description: Crystal structural of native SpaS C-terminal domain
Class: membrane protein, protein transport
Keywords: Auto cleavage protein, flagella, EscU, YscU, Intein, T3SS, membrane, Inner membrane, Transmembrane, Virulence, MEMBRANE PROTEIN, PROTEIN TRANSPORT
Deposited on 2008-01-18, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (Start-47)
  Domains in SCOPe 2.08: d3c01.1
• Chain 'B':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (Start-47)
• Chain 'C':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (Start-47)
• Chain 'D':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (Start-47)
• Chain 'E':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (0-End)
  Domains in SCOPe 2.08: d3c01.1
• Chain 'F':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (0-End)
• Chain 'G':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (0-End)
• Chain 'H':
  Compound: surface presentation of antigens protein spas
  Species: Salmonella typhimurium [TaxId:602]
  Gene: spas
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40702 (0-End)
• Heterogens: SO4, CYS, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3c01A (A:)
  mdkeevkremkeqegnpevkskrrevhmeilseqvksdiensrlivan
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3c01A (A:)
  eilseqvksdiensrlivan
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >3c01E (E:)
  pthitigiyfkpelmpipmisvyetnqralavrayaekvgvpvivdiklarslfkthrry
  dlvsleeidevlrllvwleevenagkdviqpqenevrh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3c01E (E:)
  pthitigiyfkpelmpipmisvyetnqralavrayaekvgvpvivdiklarslfkthrry
  dlvsleeidevlrllvwleevenagkdv
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.