PDB entry 3bzz

View 3bzz on RCSB PDB site
Description: Crystal structural of the mutated R313T EscU/SpaS C-terminal domain
Class: membrane protein, protein transport
Keywords: Auto cleavage protein, Intein, flagella, T3SS, MEMBRANE PROTEIN, PROTEIN TRANSPORT
Deposited on 2008-01-18, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EscU
    Species: Escherichia coli [TaxId:562]
    Gene: escU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bzz.1
  • Chain 'B':
    Compound: EscU
    Species: Escherichia coli [TaxId:562]
    Gene: escU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AJ26 (0-End)
      • engineered (50)
    Domains in SCOPe 2.08: d3bzz.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3bzzA (A:)
gshmasmskdevkreakdtdgnpeikgerrrlhseiqsgslannikkstvivkn

    Sequence, based on observed residues (ATOM records): (download) 
    >3bzzA (A:)
iqsgslannikkstvivkn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3bzzB (B:)
pthiaiclyyklgetplplvietgkdakalqiiklaelydipviediplatslyknihkg
qyitedffepvaqliriaidldy

    Sequence, based on observed residues (ATOM records): (download) 
    >3bzzB (B:)
pthiaiclyyklgetplplvietgkdakalqiiklaelydipviediplatslyknihkg
qyitedffepvaqliriaidl