PDB entry 3bzy
View 3bzy on RCSB PDB site
Description: Crystal structure of the mutated Y316D EscU C-terminal domain
Class: membrane protein, protein transport
Keywords: Auto cleavage protein, flagella, Intein, T3SS, membrane, MEMBRANE PROTEIN, PROTEIN TRANSPORT
Deposited on
2008-01-18, released
2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: EscU
Species: Escherichia coli [TaxId:562]
Gene: escU
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3bzy.1 - Chain 'B':
Compound: EscU
Species: Escherichia coli [TaxId:562]
Gene: escU
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3bzy.1 - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3bzyA (A:)
gshmasmskdevkreakdtdgnpeikgerrrlhseiqsgslannikkstvivkn
Sequence, based on observed residues (ATOM records): (download)
>3bzyA (A:)
sgslannikkstvivkn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3bzyB (B:)
pthiaiclyyklgetplplvietgkdakalqiiklaelydipviediplarsldknihkg
qyitedffepvaqliriaidldy