PDB entry 3bzu

View 3bzu on RCSB PDB site
Description: Crystal structure of human 11-beta-hydroxysteroid dehydrogenase(HSD1) in complex with NADP and thiazolone inhibitor
Class: Oxidoreductase
Keywords: 11beta hydroxysteroid dehydrogenase, Endoplasmic reticulum, Glycoprotein, Lipid metabolism, Membrane, Microsome, NADP, Oxidoreductase, Polymorphism, Signal-anchor, Steroid metabolism, Transmembrane
Deposited on 2008-01-18, released 2008-06-10
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-10, with a file datestamp of 2008-06-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845
      • engineered (265)
    Domains in SCOP 1.75: d3bzua1
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (15-16)
      • engineered (265)
    Domains in SCOP 1.75: d3bzub1
  • Chain 'C':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • engineered (265)
    Domains in SCOP 1.75: d3bzuc1
  • Chain 'D':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845
      • engineered (265)
    Domains in SCOP 1.75: d3bzud1
  • Heterogens: NAP, A21, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bzuA (A:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bzuA (A:)
    eefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa
    sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf
    lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs
    rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwt
    tllirnpsrkileflystsynmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bzuB (B:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bzuB (B:)
    plneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclel
    gaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksme
    vnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkey
    svsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydss
    lwttllirnpsrkileflysts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bzuC (C:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bzuC (C:)
    neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
    asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
    flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
    srvnvsitlcvlglidtetamkavmqaapkeecaleiikggalrqeevyydsslwttlli
    rnpsrkileflyst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bzuD (D:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bzuD (D:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtaretlqkvvshclelgaasah
    yiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnflsy
    vvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsrvn
    vsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwttll
    irnpsrkileflys