PDB entry 3bzo

View 3bzo on RCSB PDB site
Description: crystal structural of native escu c-terminal domain
Deposited on 2008-01-18, released 2008-04-22
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EscU
    Species: Escherichia coli [TaxId:562]
    Gene: escU
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: EscU
    Species: Escherichia coli [TaxId:562]
    Gene: escU
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3bzoA (A:)
gshmasmskdevkreakdtdgnpeikgerrrlhseiqsgslannikkstvivkn

    Sequence, based on observed residues (ATOM records):
    >3bzoA (A:)
sgslannikkstvivkn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3bzoB (B:)
pthiaiclyyklgetplplvietgkdakalqiiklaelydipviediplarslyknihkg
qyitedffepvaqliriaidldy

    Sequence, based on observed residues (ATOM records):
    >3bzoB (B:)
thiaiclyyklgetplplvietgkdakalqiiklaelydipviediplarslyknihkgq
yitedffepvaqliriaidldy