PDB entry 3bzd

View 3bzd on RCSB PDB site
Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Class: toxin
Keywords: Superantigen, Secreted, TOXIN
Deposited on 2008-01-17, released 2009-05-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor beta chain 8.2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BZD (0-108)
    Domains in SCOPe 2.01: d3bzda_
  • Chain 'B':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5
      • see remark 999 (101-103)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bzdA (A:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'B':
    No sequence available.