PDB entry 3bz9

View 3bz9 on RCSB PDB site
Description: Crystal Structures of (S)-(-)-Blebbistatin Analogs bound to Dictyostelium discoideum myosin II
Class: contractile protein
Keywords: myosin inhibitor, motor domain, blebbistatin analogue, Actin-binding, ATP-binding, Calmodulin-binding, Coiled coil, Cytoplasm, Methylation, Motor protein, Nucleotide-binding, Phosphoprotein, CONTRACTILE PROTEIN
Deposited on 2008-01-17, released 2008-02-19
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-17, with a file datestamp of 2008-06-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-2 heavy chain, non muscle
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: MHCA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bz9a1
  • Heterogens: MG, VO4, ADP, BL7, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bz9A (A:)
    gnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz9A (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglf
    lvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesg
    agktentkkviqylasvagrgvleqqilqanpileafgnakttrnnnssrfgkfieiqfn
    sagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnyln
    qsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegav
    lkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygr
    lflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfk
    leqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklh
    shfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvv
    tklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakle
    dkvvldqlrcngvlegiritrkgfpnriiyfvqyrfgitkiffr