PDB entry 3bys

View 3bys on RCSB PDB site
Description: co-crystal structure of Lck and aminopyrimidine amide 10b
Class: transferase
Keywords: Lck, Kinase domain, Alternative splicing, ATP-binding, Chromosomal rearrangement, Cytoplasm, Disease mutation, Host-virus interaction, Lipoprotein, Membrane, Myristate, Nucleotide-binding, Palmitate, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-01-16, released 2008-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.246
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bysa_
  • Heterogens: AM5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bysA (A:)
    qtqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspda
    flaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldm
    aaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpi
    kwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdn
    cpeelyqlmrlcwkerpedrptfdylrsvledfftat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bysA (A:)
    qkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaea
    nlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqia
    egmafieernyihrdlraanilvsdtlsckiadfglpikwtapeainygtftiksdvwsf
    gillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrpt
    fdylrsvledfftat