PDB entry 3byo

View 3byo on RCSB PDB site
Description: X-Ray co-crystal structure of 2-amino-6-phenylpyrimido[5',4':5,6]pyrimido[1,2-a]benzimidazol-5(6H)-one 25 bound to Lck
Class: transferase
Keywords: Lck, kinase domain, Alternative splicing, ATP-binding, Chromosomal rearrangement, Cytoplasm, Disease mutation, Host-virus interaction, Lipoprotein, Membrane, Myristate, Nucleotide-binding, Palmitate, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-01-16, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3byoa_
  • Heterogens: SO4, AM9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3byoA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftat