PDB entry 3byk

View 3byk on RCSB PDB site
Description: Crystal structure of B. subtilis levansucrase mutant D247A
Class: transferase
Keywords: beta propeller, TRANSFERASE
Deposited on 2008-01-16, released 2008-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Levansucrase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05655 (Start-472)
      • engineered (246)
    Domains in SCOPe 2.08: d3byka_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bykA (A:)
    mnikkfakqatvltfttallaggatqafaketnqkpyketygishitrhdmlqipeqqkn
    ekyqvpefdsstiknissakgldvwdswplqnadgtvanyhgyhivfalagdpknaddts
    iymfyqkvgetsidswknagrvfkdsdkfdandsilkdqtqewsgsatftsdgkirlfyt
    dfsgkhygkqtlttaqvnvsasdsslningvedyksifdgdgktyqnvqqfidegnyssg
    dnhtlraphyvedkghkylvfeantgtedgyqgeeslfnkayygkstsffrqesqkllqs
    dkkrtaelangalgmielnddytlkkvmkpliasntvtdeieranvfkmngkwylftdsr
    gskmtidgitsndiymlgyvsnsltgpykplnktglvlkmdldpndvtftyshfavpqak
    gnnvvitsymtnrgfyadkqstfapsfllnikgkktsvvkdsileqgqltvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bykA (A:)
    qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
    dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
    silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
    yksifdgdgktyqnvqqfidegnyssgdnhtlraphyvedkghkylvfeantgtedgyqg
    eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
    sntvtdeieranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
    tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
    kktsvvkdsileqgqltvnk