PDB entry 3byb

View 3byb on RCSB PDB site
Description: Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom
Class: hydrolase inhibitor
Keywords: BPTI-like, beta hairpin, Kunitz-type protease inhibitor, trypsin, plasmin, HYDROLASE INHIBITOR
Deposited on 2008-01-15, released 2009-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.193
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Textilinin
    Species: Pseudonaja textilis textilis [TaxId:169397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3byba_
  • Chain 'B':
    Compound: Textilinin
    Species: Pseudonaja textilis textilis [TaxId:169397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bybb_
  • Chain 'C':
    Compound: Textilinin
    Species: Pseudonaja textilis textilis [TaxId:169397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bybc_
  • Heterogens: SO4, ETX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3bybA (A:)
kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa

    Sequence, based on observed residues (ATOM records): (download) 
    >3bybA (A:)
kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3bybB (B:)
kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa

    Sequence, based on observed residues (ATOM records): (download) 
    >3bybB (B:)
drpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3bybC (C:)
kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa

    Sequence, based on observed residues (ATOM records): (download) 
    >3bybC (C:)
kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca