PDB entry 3by8

View 3by8 on RCSB PDB site
Description: Crystal Structure of the E.coli DcuS Sensor Domain
Class: transferase
Keywords: histidine kinase sensor domain, Inner membrane, Membrane, Phosphoprotein, Transferase, Transmembrane, Two-component regulatory system
Deposited on 2008-01-15, released 2008-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-21, with a file datestamp of 2021-04-16.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein dcuS
    Species: ESCHERICHIA COLI
    Gene: dcuS, yjdH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3by8a_
  • Heterogens: LMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3by8A (A:)
    gssqisdmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfiv
    vtdmqslryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkq
    igvvaiglelsrvtqqindsrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3by8A (A:)
    dmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmqs
    lryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvvai
    glelsrvtqqind