PDB entry 3bxv

View 3bxv on RCSB PDB site
Description: Crystal structure studies on sulfur oxygenase reductase from Acidianus tengchongensis
Class: oxidoreductase
Keywords: beta barrel, OXIDOREDUCTASE
Deposited on 2008-01-14, released 2009-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-20, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfur oxygenase/reductase
    Species: Acidianus tengchongenses
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q977W3 (0-307)
      • engineered (173)
      • engineered (237)
    Domains in SCOPe 2.06: d3bxva_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bxvA (A:)
    mpkpyiainmadlknepktfemfsavgpkvcmvtarhpgfvgfqnhvqigvlpfgerfgg
    akmdmtkesstvrvlqytmwkdwkdheemhrqnwsylfrlcyscasqmvwgpwepiyeik
    yadmpintemtdftavvgkkfaegkpleipvisqpygkrvvafgehtvipgkeeqfedai
    iktlemfkrapgflgamllkeigvsgigsfqfgskgfhqllespgslepdpnnvmyqape
    akptppqyivhvewanldalqfgmgrvllspeyrevhdealdtliygpyiriinpvmegt
    fwreylne