PDB entry 3bxu

View 3bxu on RCSB PDB site
Description: PpcB, A Cytochrome c7 from Geobacter sulfurreducens
Class: electron transport
Keywords: Multiheme cytochromes, cytochrome c7 Geobacter sulfurreducens, ELECTRON TRANSPORT
Deposited on 2008-01-14, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.164
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Geobacter sulfurreducens
  Gene: cyd-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q74G83 (0-70)
  Domains in SCOPe 2.08: d3bxua_
• Chain 'B':
  Compound: cytochrome c3
  Species: Geobacter sulfurreducens
  Gene: cyd-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q74G83 (0-70)
  Domains in SCOPe 2.08: d3bxub_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bxuA (A:)
  adtmtftakngnvtfdhkkhqtivpdcavchgktpgkiegfgkemahgksckgcheemkk
  gptkcgechkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bxuB (B:)
  adtmtftakngnvtfdhkkhqtivpdcavchgktpgkiegfgkemahgksckgcheemkk
  gptkcgechkk