PDB entry 3bxq

View 3bxq on RCSB PDB site
Description: The structure of a mutant insulin uncouples receptor binding from protein allostery. An electrostatic block to the TR transition
Class: hormone
Keywords: TR transition, Electrostatic block, Protein allostery, Receptor binding, Hormone
Deposited on 2008-01-14, released 2008-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.206
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: insulin B chain
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered (4)
  Domains in SCOPe 2.08: d3bxqb1
• Chain 'C':
  Compound: insulin A chain
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'D':
  Compound: insulin B chain
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered (4)
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bxqB (B:)
  fvnqrlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.