PDB entry 3bxh

View 3bxh on RCSB PDB site
Description: Crystal structure of effector binding domain of central glycolytic gene regulator (CggR) from Bacillus subtilis in complex with fructose-6-phosphate
Class: gene regulation
Keywords: effector binding domain, catabolic repressor, transcriptional regulator, DeoR family, DNA-binding, Transcription regulation, GENE REGULATION
Deposited on 2008-01-13, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.163
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Central glycolytic gene regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: cggR, yvbQ, BSU33950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bxha_
  • Chain 'B':
    Compound: Central glycolytic gene regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: cggR, yvbQ, BSU33950
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32253 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3bxhb2, d3bxhb3
  • Heterogens: F6P, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bxhA (A:)
    snakdvlgltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgkniv
    avtggttieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllf
    vpgqlsqgayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddnd
    avteafgyyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntv
    lvtdegaakkllrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxhA (A:)
    gltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavtggtt
    ieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpgqlsq
    gayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavteafg
    yyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvtdega
    akkllrde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bxhB (B:)
    snakdvlgltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgkniv
    avtggttieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllf
    vpgqlsqgayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddnd
    avteafgyyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntv
    lvtdegaakkllrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxhB (B:)
    snakdvlgltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgkniv
    avtggttieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllf
    vpgqlsqgayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddnd
    avteafgyyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntv
    lvtdegaakkllr