PDB entry 3bxd

View 3bxd on RCSB PDB site
Description: Crystal structure of Mouse Myo-inositol oxygenase (re-refined)
Class: oxidoreductase
Keywords: protein-substrate complex, hd domain fold, diiron, oxidoreductase
Deposited on 2008-01-13, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol oxygenase
    Species: Mus musculus [TaxId:10090]
    Gene: Miox, Aldrl6, Rsor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bxda_
  • Heterogens: FE, OH, INS, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bxdA (A:)
    gamgmkvdvgpdpslvyrpdvdpemakskdsfrnytsgplldrvfttyklmhthqtvdfv
    srkriqygsfsykkmtimeavgmlddlvdesdpdvdfpnsfhafqtaegirkahpdkdwf
    hlvgllhdlgkimalwgepqwavvgdtfpvgcrpqasvvfcdstfqdnpdlqdprystel
    gmyqphcglenvlmswghdeylyqmmkfnkfslpseafymirfhsfypwhtggdyrqlcs
    qqdldmlpwvqefnkfdlytkcpdlpdveslrpyyqglidkycpgtlsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxdA (A:)
    frnytsgplldrvfttyklmhthqtvdfvsrkriqygsfsykkmtimeavgmlddlvdes
    dpdvdfpnsfhafqtaegirkahpdkdwfhlvgllhdlgkimalwgepqwavvgdtfpvg
    crpqasvvfcdstfqdnpdlqdprystelgmyqphcglenvlmswghdeylyqmmkfnkf
    slpseafymirfhsfypwhtggdyrqlcsqqdldmlpwvqefnkfdlytkcpdlpdvesl
    rpyyqglidkycpgtlsw