PDB entry 3bxc

View 3bxc on RCSB PDB site
Description: Monomeric Far-red Fluorescent Protein mKate Crystallized at pH 9.0
Class: fluorescent protein
Keywords: Far-red fluorescent protein, E. quadricolor, Chromophore structure, pH-induced cis-trans izomerization
Deposited on 2008-01-12, released 2008-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxca_
  • Chain 'B':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxcb_
  • Chain 'C':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxcc_
  • Chain 'D':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxcd_
  • Chain 'E':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxce_
  • Chain 'F':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxcf_
  • Chain 'G':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxcg_
  • Chain 'H':
    Compound: Far-red fluorescent protein mKate
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BXC
    Domains in SCOPe 2.06: d3bxch_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bxcA (A:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcA (A:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bxcB (B:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcB (B:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bxcC (C:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcC (C:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bxcD (D:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcD (D:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bxcE (E:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcE (E:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bxcF (F:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcF (F:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3bxcG (G:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcG (G:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bxcH (H:)
    mrgshhhhhhgsmselitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggg
    hlicnlkttyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bxcH (H:)
    itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
    gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
    nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
    knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp